PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12203A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 720aa    MW: 78565.1 Da    PI: 8.2732
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12203AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73e-14154201148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                +g W++eEd++l d + ++G g+W++ +++ g+ R +k+c++rw +yl
  Oropetium_20150105_12203A 154 KGLWSPEEDQKLRDFIVRYGHGCWSALPAKAGLQRNGKSCRLRWINYL 201
                                678*******************************************97 PP

2Myb_DNA-binding537.9e-17208252248
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                g ++ eE+e   +++++lG++ W+ Iar+++ gRt++++k++w++yl
  Oropetium_20150105_12203A 208 GMFSNEEEETVMKLHAKLGNK-WSHIARHLP-GRTDNEVKNYWNSYL 252
                                5699*****************.*********.*************97 PP

3Myb_DNA-binding574.4e-18442489148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                +g+WT+eEd+llvd v+  G+g+W++ ++  g++R++k+c++rw +yl
  Oropetium_20150105_12203A 442 KGPWTPEEDKLLVDFVQANGSGNWRLLPKLAGLNRCGKSCRLRWTNYL 489
                                79********************************************97 PP

4Myb_DNA-binding50.83.7e-16495540148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                rg++TteE+  +v+++   G++ W+ Ia+ ++ gRt++++k++w+++l
  Oropetium_20150105_12203A 495 RGAFTTEEHNTIVQLHGIVGNK-WSMIAAQLP-GRTDNEIKNYWNTHL 540
                                89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.756149201IPR017930Myb domain
SuperFamilySSF466891.03E-27152248IPR009057Homeodomain-like
SMARTSM007174.0E-11153203IPR001005SANT/Myb domain
PfamPF002491.9E-12154201IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-20155208IPR009057Homeodomain-like
CDDcd001671.03E-9157201No hitNo description
PROSITE profilePS5129425.764202256IPR017930Myb domain
SMARTSM007171.3E-14206254IPR001005SANT/Myb domain
PfamPF002492.7E-15208252IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-25209255IPR009057Homeodomain-like
CDDcd001677.89E-12210252No hitNo description
Gene3DG3DSA:1.10.10.604.9E-23433492IPR009057Homeodomain-like
PROSITE profilePS5129418.304437489IPR017930Myb domain
SuperFamilySSF466893.74E-30439536IPR009057Homeodomain-like
SMARTSM007171.5E-14441491IPR001005SANT/Myb domain
PfamPF002491.3E-16442489IPR001005SANT/Myb domain
CDDcd001671.04E-10444489No hitNo description
PROSITE profilePS5129426.468490544IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-25493544IPR009057Homeodomain-like
SMARTSM007173.9E-14494542IPR001005SANT/Myb domain
PfamPF002492.0E-13495540IPR001005SANT/Myb domain
CDDcd001671.26E-9497540No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 720 aa     Download sequence    Send to blast
MATHVDVQWC RDTAVHGEAS QRGNVWKQQR RHAYAAYGNV SAQTVPRTDN WCGGRRLPTS  60
LPQPHPNMLR PYSVRPERPL PARQRRPTTP QCERTSNLSL LSSVLCGFTL PPLPPPRFLA  120
VTCSTSSSVA FLTPPPAKAM GCKACEKPKV QYRKGLWSPE EDQKLRDFIV RYGHGCWSAL  180
PAKAGLQRNG KSCRLRWINY LRPGLKHGMF SNEEEETVMK LHAKLGNKWS HIARHLPGRT  240
DNEVKNYWNS YLKKRVEGAQ ASKCADDAPP ADSDDVSGSP NTSETTSQER LNRPASSASS  300
SPDDSSCLTV TEPAATATAV RPHAPVLPKV MFADWLDMDM DYGTSLVAAP DGPCGGAADS  360
LQGLDGGGVC WGFDVAADQM DVQGGGFCDL LSMSERTTNS NVQRQPQPLQ HYSQQHQQWL  420
RQNQMATTMG RTPCCDGKGV KKGPWTPEED KLLVDFVQAN GSGNWRLLPK LAGLNRCGKS  480
CRLRWTNYLR PDIKRGAFTT EEHNTIVQLH GIVGNKWSMI AAQLPGRTDN EIKNYWNTHL  540
KKQLRQESSL GEDAAARLAA PVAASSSPAA RHMAQWETAR LEAEARLSLL SXXXXXXXXX  600
XXXXXGAEHA ATAPDIFLRL WNSEVGESFR GAAAGSVQTA NALLAVPTGA VLRPVPGDES  660
SAASTNDNNN GAAMMADEYQ AFLDMAVEEF ALLHGRLGGF AVFPAADVLA GASLFAPFE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-271545447109B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0915921e-124FP091592.1 Phyllostachys edulis cDNA clone: bphylf055c23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976342.11e-134PREDICTED: transcription factor LAF1-like
TrEMBLK3YDJ91e-134K3YDJ9_SETIT; Uncharacterized protein
STRINGSi012304m1e-134(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.19e-67myb domain protein 17